SCOP 1.71: Domain d1ni4c_: 1ni4 C:

Lineage for d1ni4c_ (1ni4 C:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (4 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89652] (1 PDB entry)

8. Domain d1ni4c_: 1ni4 C: [85731]
   Other proteins in same PDB: d1ni4b1, d1ni4b2, d1ni4d1, d1ni4d2
   complexed with k, mg, mse, tpp; mutant

Details for d1ni4c_

PDB Entry: 1ni4, 1.95 Å

PDB Description: human pyruvate dehydrogenase

SCOP Domain Sequences for d1ni4c_:

Sequence; same for both SEQRES and ATOM records:

>d1ni4c_ c.36.1.11 (C:) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens)}
sfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
nmaalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrf
aaaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiqevrsksdpimllkdrmvnsn
lasveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfks
vs

Timeline for d1ni4c_:

• d1ni4c_ first appeared in SCOP 1.65
  
• d1ni4c_ appears in SCOP 1.69
  
• d1ni4c_ appears in SCOP 1.73
  
• d1ni4c_ appears in the current release, SCOPe 2.08, called d1ni4c1