Lineage for d1ni4c1 (1ni4 C:1-361)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865076Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 2865110Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 2865111Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries)
  8. 2865115Domain d1ni4c1: 1ni4 C:1-361 [85731]
    Other proteins in same PDB: d1ni4a2, d1ni4b1, d1ni4b2, d1ni4b3, d1ni4c2, d1ni4d1, d1ni4d2, d1ni4d3
    complexed with k, mg, tpp

Details for d1ni4c1

PDB Entry: 1ni4 (more details), 1.95 Å

PDB Description: human pyruvate dehydrogenase
PDB Compounds: (C:) Pyruvate dehydrogenase E1 component: Alpha subunit

SCOPe Domain Sequences for d1ni4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni4c1 c.36.1.11 (C:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrfa
aaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiqevrsksdpimllkdrmvnsnl
asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv
s

SCOPe Domain Coordinates for d1ni4c1:

Click to download the PDB-style file with coordinates for d1ni4c1.
(The format of our PDB-style files is described here.)

Timeline for d1ni4c1: