Lineage for d1ni4b2 (1ni4 B:192-329)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834846Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 834847Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 834899Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
  6. 834939Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)
  7. 834942Species Human (Homo sapiens) [TaxId:9606] [89713] (2 PDB entries)
  8. 834945Domain d1ni4b2: 1ni4 B:192-329 [85730]
    Other proteins in same PDB: d1ni4a_, d1ni4b1, d1ni4c_, d1ni4d1

Details for d1ni4b2

PDB Entry: 1ni4 (more details), 1.95 Å

PDB Description: human pyruvate dehydrogenase
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component: Beta subunit

SCOP Domain Sequences for d1ni4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni4b2 c.48.1.2 (B:192-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
lipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmdmetiea
svmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpyakiledn
sipqvkdiifaikktlni

SCOP Domain Coordinates for d1ni4b2:

Click to download the PDB-style file with coordinates for d1ni4b2.
(The format of our PDB-style files is described here.)

Timeline for d1ni4b2: