Lineage for d1ni4b1 (1ni4 B:0-191)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581036Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 581037Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 581162Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 581191Protein E1-beta subunit of pyruvate dehydrogenase, Pyr module [69472] (2 species)
  7. 581194Species Human (Homo sapiens) [TaxId:9606] [89653] (1 PDB entry)
  8. 581195Domain d1ni4b1: 1ni4 B:0-191 [85729]
    Other proteins in same PDB: d1ni4a_, d1ni4b2, d1ni4c_, d1ni4d2

Details for d1ni4b1

PDB Entry: 1ni4 (more details), 1.95 Å

PDB Description: human pyruvate dehydrogenase

SCOP Domain Sequences for d1ni4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni4b1 c.36.1.7 (B:0-191) E1-beta subunit of pyruvate dehydrogenase, Pyr module {Human (Homo sapiens)}
slqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpise
mgfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpng
asagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvp
fefppeaqskdf

SCOP Domain Coordinates for d1ni4b1:

Click to download the PDB-style file with coordinates for d1ni4b1.
(The format of our PDB-style files is described here.)

Timeline for d1ni4b1: