Lineage for d1ni4a_ (1ni4 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393047Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 393048Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 393299Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (3 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 393318Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 393319Species Human (Homo sapiens) [TaxId:9606] [89652] (1 PDB entry)
  8. 393320Domain d1ni4a_: 1ni4 A: [85728]
    Other proteins in same PDB: d1ni4b1, d1ni4b2, d1ni4d1, d1ni4d2

Details for d1ni4a_

PDB Entry: 1ni4 (more details), 1.95 Å

PDB Description: human pyruvate dehydrogenase

SCOP Domain Sequences for d1ni4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ni4a_ c.36.1.11 (A:) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens)}
sfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
nmaalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrf
aaaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiqevrsksdpimllkdrmvnsn
lasveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfks
vs

SCOP Domain Coordinates for d1ni4a_:

Click to download the PDB-style file with coordinates for d1ni4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ni4a_: