Lineage for d1nhja2 (1nhj A:1-216)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973765Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (7 proteins)
  6. 2973775Protein DNA mismatch repair protein MutL [55882] (1 species)
  7. 2973776Species Escherichia coli [TaxId:562] [55883] (6 PDB entries)
  8. 2973781Domain d1nhja2: 1nhj A:1-216 [85721]
    Other proteins in same PDB: d1nhja1, d1nhja3
    protein/DNA complex; complexed with anp, mg, na; mutant

Details for d1nhja2

PDB Entry: 1nhj (more details), 2.3 Å

PDB Description: crystal structure of n-terminal 40kd mutl/a100p mutant protein complex with adpnp and one sodium
PDB Compounds: (A:) DNA mismatch repair protein mutL

SCOPe Domain Sequences for d1nhja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhja2 d.122.1.2 (A:1-216) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
mpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirirdng
cgikkdelalalarhatskiaslddleaiislgfrgealpsissvsrltltsrtaeqqea
wqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirrial
arfdvtinlshngkivrqyravpeggqkerrlgaic

SCOPe Domain Coordinates for d1nhja2:

Click to download the PDB-style file with coordinates for d1nhja2.
(The format of our PDB-style files is described here.)

Timeline for d1nhja2: