Lineage for d1nhja1 (1nhj A:217-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176534Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 2176542Protein DNA mismatch repair protein MutL [54225] (1 species)
  7. 2176543Species Escherichia coli [TaxId:562] [54226] (6 PDB entries)
  8. 2176548Domain d1nhja1: 1nhj A:217-331 [85720]
    Other proteins in same PDB: d1nhja2, d1nhja3
    protein/DNA complex; complexed with anp, mg, na; mutant

Details for d1nhja1

PDB Entry: 1nhj (more details), 2.3 Å

PDB Description: crystal structure of n-terminal 40kd mutl/a100p mutant protein complex with adpnp and one sodium
PDB Compounds: (A:) DNA mismatch repair protein mutL

SCOPe Domain Sequences for d1nhja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhja1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

SCOPe Domain Coordinates for d1nhja1:

Click to download the PDB-style file with coordinates for d1nhja1.
(The format of our PDB-style files is described here.)

Timeline for d1nhja1: