Lineage for d1nhja1 (1nhj A:217-331)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325230Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 325231Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (7 families) (S)
  5. 325290Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (4 proteins)
  6. 325298Protein DNA mismatch repair protein MutL [54225] (1 species)
  7. 325299Species Escherichia coli [TaxId:562] [54226] (6 PDB entries)
  8. 325304Domain d1nhja1: 1nhj A:217-331 [85720]
    Other proteins in same PDB: d1nhja2
    complexed with anp, mg, na; mutant

Details for d1nhja1

PDB Entry: 1nhj (more details), 2.3 Å

PDB Description: crystal structure of n-terminal 40kd mutl/a100p mutant protein complex with adpnp and one sodium

SCOP Domain Sequences for d1nhja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhja1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

SCOP Domain Coordinates for d1nhja1:

Click to download the PDB-style file with coordinates for d1nhja1.
(The format of our PDB-style files is described here.)

Timeline for d1nhja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nhja2