Lineage for d1nhia1 (1nhi A:217-331)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537433Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 2537441Protein DNA mismatch repair protein MutL [54225] (1 species)
  7. 2537442Species Escherichia coli [TaxId:562] [54226] (6 PDB entries)
  8. 2537444Domain d1nhia1: 1nhi A:217-331 [85718]
    Other proteins in same PDB: d1nhia2, d1nhia3
    protein/DNA complex; complexed with anp, edo, k, mg

Details for d1nhia1

PDB Entry: 1nhi (more details), 2 Å

PDB Description: Crystal structure of N-terminal 40KD MutL (LN40) complex with ADPnP and one potassium
PDB Compounds: (A:) DNA mismatch repair protein mutL

SCOPe Domain Sequences for d1nhia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nhia1 d.14.1.3 (A:217-331) DNA mismatch repair protein MutL {Escherichia coli [TaxId: 562]}
gtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqac
edklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq

SCOPe Domain Coordinates for d1nhia1:

Click to download the PDB-style file with coordinates for d1nhia1.
(The format of our PDB-style files is described here.)

Timeline for d1nhia1: