Lineage for d1nh6a3 (1nh6 A:444-516)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644292Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1644695Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1644696Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1644739Protein Chitinase A [54558] (1 species)
  7. 1644740Species Serratia marcescens [TaxId:615] [54559] (11 PDB entries)
    Uniprot P07254 24-563
  8. 1644748Domain d1nh6a3: 1nh6 A:444-516 [85715]
    Other proteins in same PDB: d1nh6a1, d1nh6a2

Details for d1nh6a3

PDB Entry: 1nh6 (more details), 2.05 Å

PDB Description: Structure of S. marcescens chitinase A, E315L, complex with hexasaccharide
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1nh6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nh6a3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiasqfmsgewqytydataeapy
vfkpstgdlitfd

SCOPe Domain Coordinates for d1nh6a3:

Click to download the PDB-style file with coordinates for d1nh6a3.
(The format of our PDB-style files is described here.)

Timeline for d1nh6a3: