Lineage for d1nh6a2 (1nh6 A:133-443,A:517-563)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440387Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2440430Protein Chitinase A, catalytic domain [51544] (1 species)
  7. 2440431Species Serratia marcescens [TaxId:615] [51545] (11 PDB entries)
    Uniprot P07254 24-563
  8. 2440437Domain d1nh6a2: 1nh6 A:133-443,A:517-563 [85714]
    Other proteins in same PDB: d1nh6a1, d1nh6a3

Details for d1nh6a2

PDB Entry: 1nh6 (more details), 2.05 Å

PDB Description: structure of s. marcescens chitinase a, e315l, complex with hexasaccharide
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1nh6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nh6a2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]}
tdgshlaplkeplleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfi
picggngindslkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgn
fgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdi
dwlfpggkganpnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidk
vaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgv
kpgkivvgtamXdarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq

SCOPe Domain Coordinates for d1nh6a2:

Click to download the PDB-style file with coordinates for d1nh6a2.
(The format of our PDB-style files is described here.)

Timeline for d1nh6a2: