Lineage for d1nh3a2 (1nh3 A:203-430)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018472Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 3018473Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
    automatically mapped to Pfam PF02919
  5. 3018474Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 3018475Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 3018478Species Human (Homo sapiens) [TaxId:9606] [56744] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 3018489Domain d1nh3a2: 1nh3 A:203-430 [85711]
    Other proteins in same PDB: d1nh3a1
    protein/DNA complex

Details for d1nh3a2

PDB Entry: 1nh3 (more details), 3.1 Å

PDB Description: human topoisomerase i ara-c complex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1nh3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nh3a2 e.15.1.1 (A:203-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOPe Domain Coordinates for d1nh3a2:

Click to download the PDB-style file with coordinates for d1nh3a2.
(The format of our PDB-style files is described here.)

Timeline for d1nh3a2: