Lineage for d1nh3a1 (1nh3 A:431-626,A:719-765)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336358Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 336359Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 336406Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 336407Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 336408Species Human (Homo sapiens) [TaxId:9606] [56363] (8 PDB entries)
  8. 336414Domain d1nh3a1: 1nh3 A:431-626,A:719-765 [85710]
    Other proteins in same PDB: d1nh3a2
    complexed with car, gng, ptr, ubb

Details for d1nh3a1

PDB Entry: 1nh3 (more details), 3.1 Å

PDB Description: human topoisomerase i ara-c complex

SCOP Domain Sequences for d1nh3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nh3a1 d.163.1.2 (A:431-626,A:719-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens)}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravXsklnyldpritvawckkwgvpiekiynktqrekfawaidmade
dyef

SCOP Domain Coordinates for d1nh3a1:

Click to download the PDB-style file with coordinates for d1nh3a1.
(The format of our PDB-style files is described here.)

Timeline for d1nh3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nh3a2