Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1ngxl2: 1ngx L:108-213 [85709] Other proteins in same PDB: d1ngxa1, d1ngxb1, d1ngxb2, d1ngxh1, d1ngxh2, d1ngxl1 part of metal chelatase catalytic Fab 7G12; chimeric germline antibody |
PDB Entry: 1ngx (more details), 1.8 Å
SCOP Domain Sequences for d1ngxl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngxl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne
Timeline for d1ngxl2: