Lineage for d1ngxa2 (1ngx A:108-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 656120Domain d1ngxa2: 1ngx A:108-213 [85703]
    Other proteins in same PDB: d1ngxa1, d1ngxb1, d1ngxb2, d1ngxh1, d1ngxh2, d1ngxl1

Details for d1ngxa2

PDB Entry: 1ngx (more details), 1.8 Å

PDB Description: chimeric germline fab 7g12 with jeffamine fragment bound
PDB Compounds: (A:) Germline Metal Chelatase Catalytic Antibody, Light chain

SCOP Domain Sequences for d1ngxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngxa2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

SCOP Domain Coordinates for d1ngxa2:

Click to download the PDB-style file with coordinates for d1ngxa2.
(The format of our PDB-style files is described here.)

Timeline for d1ngxa2: