SCOP 1.71: Domain d1ngxa2: 1ngx A:108-213

Lineage for d1ngxa2 (1ngx A:108-213)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1ngxa2: 1ngx A:108-213 [85703]
   Other proteins in same PDB: d1ngxa1, d1ngxb1, d1ngxb2, d1ngxh1, d1ngxh2, d1ngxl1

Details for d1ngxa2

PDB Entry: 1ngx, 1.8 Å

PDB Description: chimeric germline fab 7g12 with jeffamine fragment bound

SCOP Domain Sequences for d1ngxa2:

Sequence; same for both SEQRES and ATOM records:

>d1ngxa2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

Timeline for d1ngxa2:

• d1ngxa2 first appeared in SCOP 1.65
  
• d1ngxa2 appears in SCOP 1.69
  
• d1ngxa2 appears in SCOP 1.73
  
• d1ngxa2 appears in the current release, SCOPe 2.08