SCOPe 2.07: Domain d1ngmn_: 1ngm N:

Lineage for d1ngmn_ (1ngm N:)

1. Root: SCOPe 2.07

2. Class j: Peptides [58231] (148 folds)

3. Fold j.104: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90297] (1 superfamily)

4. Superfamily j.104.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90298] (1 family)

5. Family j.104.1.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90299] (1 protein)

6. Protein TBP-binding domain of the transcription factor IIIb Brf1 subunit [90300] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90301] (1 PDB entry)

8. Domain d1ngmn_: 1ngm N: [85696]
   Other proteins in same PDB: d1ngma1, d1ngma2, d1ngmb2, d1ngme1, d1ngme2, d1ngmf2, d1ngmi1, d1ngmi2, d1ngmm1, d1ngmm2
   protein/DNA complex

Details for d1ngmn_

PDB Entry: 1ngm, 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex

PDB Compounds: (N:) Transcription factor IIIB BRF1 subunit

SCOPe Domain Sequences for d1ngmn_:

Sequence; same for both SEQRES and ATOM records:

>d1ngmn_ j.104.1.1 (N:) TBP-binding domain of the transcription factor IIIb Brf1 subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kvsddpdnledvddeelnahllneeasklkeriwiglnadflleqeskrlkqe

Timeline for d1ngmn_:

• d1ngmn_ first appeared in SCOP 1.65
  
• d1ngmn_ appears in SCOPe 2.06
  
• d1ngmn_ appears in the current release, SCOPe 2.08