Class j: Peptides [58231] (133 folds) |
Fold j.104: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90297] (1 superfamily) |
Superfamily j.104.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90298] (1 family) |
Family j.104.1.1: TBP-binding domain of the transcription factor IIIb Brf1 subunit [90299] (1 protein) |
Protein TBP-binding domain of the transcription factor IIIb Brf1 subunit [90300] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90301] (1 PDB entry) |
Domain d1ngmj_: 1ngm J: [85693] Other proteins in same PDB: d1ngma1, d1ngma2, d1ngmb2, d1ngme1, d1ngme2, d1ngmf2, d1ngmi1, d1ngmi2, d1ngmm1, d1ngmm2 protein/DNA complex |
PDB Entry: 1ngm (more details), 2.95 Å
SCOPe Domain Sequences for d1ngmj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngmj_ j.104.1.1 (J:) TBP-binding domain of the transcription factor IIIb Brf1 subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kvsddpdnledvddeelnahllneeasklkeriwiglnadflleqeskrlkqe
Timeline for d1ngmj_: