Lineage for d1ngmi1 (1ngm I:61-155)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538747Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2538748Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2538749Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2538750Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 2538769Domain d1ngmi1: 1ngm I:61-155 [85691]
    Other proteins in same PDB: d1ngmb1, d1ngmb2, d1ngmf1, d1ngmf2, d1ngmj_, d1ngmn_
    a ternary complex with DNA and Brf1 peptide
    protein/DNA complex

Details for d1ngmi1

PDB Entry: 1ngm (more details), 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex
PDB Compounds: (I:) Transcription initiation factor TFIID

SCOPe Domain Sequences for d1ngmi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngmi1 d.129.1.1 (I:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdf

SCOPe Domain Coordinates for d1ngmi1:

Click to download the PDB-style file with coordinates for d1ngmi1.
(The format of our PDB-style files is described here.)

Timeline for d1ngmi1: