Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries) |
Domain d1ngme2: 1ngm E:156-240 [85689] Other proteins in same PDB: d1ngmb1, d1ngmb2, d1ngmf1, d1ngmf2, d1ngmj_, d1ngmn_ a ternary complex with DNA and Brf1 peptide protein/DNA complex |
PDB Entry: 1ngm (more details), 2.95 Å
SCOPe Domain Sequences for d1ngme2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngme2 d.129.1.1 (E:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt gakqreeiyqafeaiypvlsefrkm
Timeline for d1ngme2: