Lineage for d1ngme2 (1ngm E:156-240)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214643Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2214644Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
    automatically mapped to Pfam PF00352
  6. 2214645Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 2214646Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries)
  8. 2214664Domain d1ngme2: 1ngm E:156-240 [85689]
    Other proteins in same PDB: d1ngmb1, d1ngmb2, d1ngmf1, d1ngmf2, d1ngmj_, d1ngmn_
    a ternary complex with DNA and Brf1 peptide
    protein/DNA complex

Details for d1ngme2

PDB Entry: 1ngm (more details), 2.95 Å

PDB Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex
PDB Compounds: (E:) Transcription initiation factor TFIID

SCOPe Domain Sequences for d1ngme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngme2 d.129.1.1 (E:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt
gakqreeiyqafeaiypvlsefrkm

SCOPe Domain Coordinates for d1ngme2:

Click to download the PDB-style file with coordinates for d1ngme2.
(The format of our PDB-style files is described here.)

Timeline for d1ngme2: