![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.129: TBP-like [55944] (4 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) ![]() |
![]() | Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats |
![]() | Protein TATA-box binding protein (TBP), C-terminal domain [55947] (4 species) structure of the N-terminal domain is not known yet |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (5 PDB entries) |
![]() | Domain d1ngma2: 1ngm A:156-240 [85686] Other proteins in same PDB: d1ngmb_, d1ngmf_, d1ngmj_, d1ngmn_ |
PDB Entry: 1ngm (more details), 2.95 Å
SCOP Domain Sequences for d1ngma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngma2 d.129.1.1 (A:156-240) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} kiqnivgscdvkfpirleglafshgtfssyepelfpgliyrmvkpkivllifvsgkivlt gakqreeiyqafeaiypvlsefrkm
Timeline for d1ngma2: