Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein) duplication: consists of two clear structural repeats automatically mapped to Pfam PF00352 |
Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species) structure of the N-terminal domain is not known yet |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55950] (7 PDB entries) |
Domain d1ngma1: 1ngm A:61-155 [85685] Other proteins in same PDB: d1ngmb_, d1ngmf_, d1ngmj_, d1ngmn_ a ternary complex with DNA and Brf1 peptide protein/DNA complex |
PDB Entry: 1ngm (more details), 2.95 Å
SCOPe Domain Sequences for d1ngma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngma1 d.129.1.1 (A:61-155) TATA-box binding protein (TBP), C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk mvvtgakseddsklasrkyariiqkigfaakftdf
Timeline for d1ngma1: