Lineage for d1ngkl_ (1ngk L:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275723Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 275724Protein Protozoan/bacterial hemoglobin [46460] (5 species)
  7. 275734Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (1 PDB entry)
  8. 275746Domain d1ngkl_: 1ngk L: [85684]
    complexed with cn, hem, so4

Details for d1ngkl_

PDB Entry: 1ngk (more details), 2.11 Å

PDB Description: Crystallographic Structure of Mycobacterium tuberculosis Hemoglobin O

SCOP Domain Sequences for d1ngkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngkl_ a.1.1.1 (L:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO}
pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
slvnspf

SCOP Domain Coordinates for d1ngkl_:

Click to download the PDB-style file with coordinates for d1ngkl_.
(The format of our PDB-style files is described here.)

Timeline for d1ngkl_: