Lineage for d1ngkf_ (1ngk F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299349Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2299350Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 2299376Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (2 PDB entries)
  8. 2299382Domain d1ngkf_: 1ngk F: [85678]
    complexed with cyn, hem, so4

Details for d1ngkf_

PDB Entry: 1ngk (more details), 2.11 Å

PDB Description: Crystallographic Structure of Mycobacterium tuberculosis Hemoglobin O
PDB Compounds: (F:) Hemoglobin-like protein HbO

SCOPe Domain Sequences for d1ngkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngkf_ a.1.1.1 (F:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}
ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
seqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaahs
lvnspf

SCOPe Domain Coordinates for d1ngkf_:

Click to download the PDB-style file with coordinates for d1ngkf_.
(The format of our PDB-style files is described here.)

Timeline for d1ngkf_: