Lineage for d1ngkb_ (1ngk B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253687Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1253688Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1253714Species Mycobacterium tuberculosis, HbO [TaxId:1773] [88965] (2 PDB entries)
  8. 1253728Domain d1ngkb_: 1ngk B: [85674]
    complexed with cyn, hem, so4

Details for d1ngkb_

PDB Entry: 1ngk (more details), 2.11 Å

PDB Description: Crystallographic Structure of Mycobacterium tuberculosis Hemoglobin O
PDB Compounds: (B:) Hemoglobin-like protein HbO

SCOPe Domain Sequences for d1ngkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngkb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}
pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
slvnspf

SCOPe Domain Coordinates for d1ngkb_:

Click to download the PDB-style file with coordinates for d1ngkb_.
(The format of our PDB-style files is described here.)

Timeline for d1ngkb_: