SCOPe 2.05: Domain d1ng6a_: 1ng6 A:

Lineage for d1ng6a_ (1ng6 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.182: GatB/YqeY motif [89094] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical)

4. Superfamily a.182.1: GatB/YqeY motif [89095] (2 families)

5. Family a.182.1.1: GatB/YqeY domain [89096] (1 protein)
   automatically mapped to Pfam PF09424

6. Protein Hypothetical protein YqeY [89097] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89098] (1 PDB entry)

8. Domain d1ng6a_: 1ng6 A: [85670]
   structural genomics

Details for d1ng6a_

PDB Entry: 1ng6, 1.4 Å

PDB Description: structure of cytosolic protein of unknown function yqey from bacillus subtilis

PDB Compounds: (A:) Hypothetical protein yqeY

SCOPe Domain Sequences for d1ng6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ng6a_ a.182.1.1 (A:) Hypothetical protein YqeY {Bacillus subtilis [TaxId: 1423]}
msllerlnqdmklymknrekdkltvvrmvkaslqneaiklkkdsltedeeltvlsrelkq
rkdslqefsnanrldlvdkvqkeldilevylpeqlseeelrtivnetiaevgasskadmg
kvmgaimpkvkgkadgslinklvssqls

Timeline for d1ng6a_:

• d1ng6a_ first appeared in SCOP 1.65
  
• d1ng6a_ appears in SCOPe 2.04
  
• d1ng6a_ appears in SCOPe 2.06
  
• d1ng6a_ appears in the current release, SCOPe 2.08