Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
Protein Glycine oxidase ThiO [89843] (1 species) |
Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries) |
Domain d1ng4b2: 1ng4 B:219-306 [85669] Other proteins in same PDB: d1ng4a1, d1ng4b1 complexed with fad, peo, po4 |
PDB Entry: 1ng4 (more details), 2.3 Å
SCOPe Domain Sequences for d1ng4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng4b2 d.16.1.3 (B:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv mkkaktmlppiqnmkvdrfwaglrpgtk
Timeline for d1ng4b2: