Lineage for d1ng4a2 (1ng4 A:219-306)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 855045Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)
  6. 855083Protein Glycine oxidase ThiO [89843] (1 species)
  7. 855084Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries)
  8. 855089Domain d1ng4a2: 1ng4 A:219-306 [85667]
    Other proteins in same PDB: d1ng4a1, d1ng4b1

Details for d1ng4a2

PDB Entry: 1ng4 (more details), 2.3 Å

PDB Description: structure of thio (glycine oxidase) from bacillus subtilis
PDB Compounds: (A:) glycine oxidase

SCOP Domain Sequences for d1ng4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng4a2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv
mkkaktmlppiqnmkvdrfwaglrpgtk

SCOP Domain Coordinates for d1ng4a2:

Click to download the PDB-style file with coordinates for d1ng4a2.
(The format of our PDB-style files is described here.)

Timeline for d1ng4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ng4a1