Lineage for d1ng4a1 (1ng4 A:1-218,A:307-364)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457696Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2457744Protein Glycine oxidase ThiO [89544] (1 species)
  7. 2457745Species Bacillus sp. [TaxId:1409] [89545] (3 PDB entries)
  8. 2457750Domain d1ng4a1: 1ng4 A:1-218,A:307-364 [85666]
    Other proteins in same PDB: d1ng4a2, d1ng4b2
    complexed with fad, peo, po4

Details for d1ng4a1

PDB Entry: 1ng4 (more details), 2.3 Å

PDB Description: structure of thio (glycine oxidase) from bacillus subtilis
PDB Compounds: (A:) glycine oxidase

SCOPe Domain Sequences for d1ng4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng4a1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]}
mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaXdgkpyigrhpedsrilfaagh
frngillapatgalisdlimnkevnqdwlhafridrk

SCOPe Domain Coordinates for d1ng4a1:

Click to download the PDB-style file with coordinates for d1ng4a1.
(The format of our PDB-style files is described here.)

Timeline for d1ng4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ng4a2