![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
![]() | Protein Glycine oxidase ThiO [89843] (1 species) |
![]() | Species Bacillus sp. [TaxId:1409] [89844] (3 PDB entries) |
![]() | Domain d1ng3b2: 1ng3 B:219-306 [85665] Other proteins in same PDB: d1ng3a1, d1ng3b1 complexed with aac, fad, po4 |
PDB Entry: 1ng3 (more details), 2.6 Å
SCOP Domain Sequences for d1ng3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng3b2 d.16.1.3 (B:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} flpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesv mkkaktmlppiqnmkvdrfwaglrpgtk
Timeline for d1ng3b2: