Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
Protein Glycine oxidase ThiO [89544] (1 species) |
Species Bacillus sp. [TaxId:1409] [89545] (3 PDB entries) |
Domain d1ng3b1: 1ng3 B:1-218,B:307-364 [85664] Other proteins in same PDB: d1ng3a2, d1ng3b2 complexed with aac, fad, po4 |
PDB Entry: 1ng3 (more details), 2.6 Å
SCOPe Domain Sequences for d1ng3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng3b1 c.3.1.2 (B:1-218,B:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaXdgkpyigrhpedsrilfaagh frngillapatgalisdlimnkevnqdwlhafridrk
Timeline for d1ng3b1: