SCOP 1.65: Domain d1ng3b1: 1ng3 B:1-218,B:307-364

Lineage for d1ng3b1 (1ng3 B:1-218,B:307-364)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (11 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Glycine oxidase ThiO [89544] (1 species)

7. Species Bacillus sp. [89545] (2 PDB entries)

8. Domain d1ng3b1: 1ng3 B:1-218,B:307-364 [85664]
   Other proteins in same PDB: d1ng3a2, d1ng3b2
   complexed with aac, fad, po4

Details for d1ng3b1

PDB Entry: 1ng3, 2.6 Å

PDB Description: complex of thio (glycine oxidase) with acetyl-glycine

SCOP Domain Sequences for d1ng3b1:

Sequence; same for both SEQRES and ATOM records:

>d1ng3b1 c.3.1.2 (B:1-218,B:307-364) Glycine oxidase ThiO {Bacillus sp.}
mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaXdgkpyigrhpedsrilfaagh
frngillapatgalisdlimnkevnqdwlhafridrk

Timeline for d1ng3b1:

• d1ng3b1 is new in SCOP 1.65
  
• d1ng3b1 appears in SCOP 1.67
  
• d1ng3b1 appears in the current release, SCOPe 2.08