Lineage for d1ng3a1 (1ng3 A:1-218,A:307-364)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309374Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 309375Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 309426Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (11 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 309451Protein Glycine oxidase ThiO [89544] (1 species)
  7. 309452Species Bacillus sp. [89545] (2 PDB entries)
  8. 309455Domain d1ng3a1: 1ng3 A:1-218,A:307-364 [85662]
    Other proteins in same PDB: d1ng3a2, d1ng3b2

Details for d1ng3a1

PDB Entry: 1ng3 (more details), 2.6 Å

PDB Description: complex of thio (glycine oxidase) with acetyl-glycine

SCOP Domain Sequences for d1ng3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng3a1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp.}
mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaXdgkpyigrhpedsrilfaagh
frngillapatgalisdlimnkevnqdwlhafridrk

SCOP Domain Coordinates for d1ng3a1:

Click to download the PDB-style file with coordinates for d1ng3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ng3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ng3a2