Lineage for d1nfsb1 (1nfs B:4-182)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211684Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2211694Protein Isopentenyl diphosphate isomerase [64370] (2 species)
  7. 2211695Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
    Uniprot Q46822
  8. 2211713Domain d1nfsb1: 1nfs B:4-182 [85641]
    Other proteins in same PDB: d1nfsb2
    complexed with ded, mg, mn

Details for d1nfsb1

PDB Entry: 1nfs (more details), 1.96 Å

PDB Description: structure and mechanism of action of isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase: complex with nipp
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1nfsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfsb1 d.113.1.2 (B:4-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk

SCOPe Domain Coordinates for d1nfsb1:

Click to download the PDB-style file with coordinates for d1nfsb1.
(The format of our PDB-style files is described here.)

Timeline for d1nfsb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nfsb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1nfsa_