SCOP 1.69: Domain d1nfsa_: 1nfs A:

Lineage for d1nfsa_ (1nfs A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (5 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (2 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (11 PDB entries)

8. Domain d1nfsa_: 1nfs A: [85640]

Details for d1nfsa_

PDB Entry: 1nfs, 1.96 Å

PDB Description: structure and mechanism of action of isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase: complex with nipp

SCOP Domain Sequences for d1nfsa_:

Sequence; same for both SEQRES and ATOM records:

>d1nfsa_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

Timeline for d1nfsa_:

• d1nfsa_ first appeared in SCOP 1.65
  
• d1nfsa_ appears in SCOP 1.67
  
• d1nfsa_ appears in SCOP 1.71
  
• d1nfsa_ appears in the current release, SCOPe 2.08