Lineage for d1nfgd1 (1nfg D:1-51,D:382-457)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965039Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 965040Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 965092Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 965093Protein D-hydantoinase [75045] (4 species)
  7. 965106Species Burkholderia pickettii [TaxId:329] [89437] (1 PDB entry)
  8. 965110Domain d1nfgd1: 1nfg D:1-51,D:382-457 [85638]
    Other proteins in same PDB: d1nfga2, d1nfgb2, d1nfgc2, d1nfgd2
    complexed with zn

Details for d1nfgd1

PDB Entry: 1nfg (more details), 2.7 Å

PDB Description: Structure of D-hydantoinase
PDB Compounds: (D:) D-hydantoinase

SCOPe Domain Sequences for d1nfgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfgd1 b.92.1.3 (D:1-51,D:382-457) D-hydantoinase {Burkholderia pickettii [TaxId: 329]}
mdiiikngtivtadgisradlgikdgkitqiggalgpaertidaagryvfpXiavgsdad
ivlwdpeaemvieqtamhnamdyssyeghkvkgvpktvllrgkvivdegsyvgeptdgkf
lkrrkykq

SCOPe Domain Coordinates for d1nfgd1:

Click to download the PDB-style file with coordinates for d1nfgd1.
(The format of our PDB-style files is described here.)

Timeline for d1nfgd1: