Lineage for d1nfgc2 (1nfg C:52-381)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683751Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
  6. 683752Protein D-hydantoinase [75074] (4 species)
  7. 683765Species Burkholderia pickettii [TaxId:329] [89488] (1 PDB entry)
  8. 683768Domain d1nfgc2: 1nfg C:52-381 [85637]
    Other proteins in same PDB: d1nfga1, d1nfgb1, d1nfgc1, d1nfgd1

Details for d1nfgc2

PDB Entry: 1nfg (more details), 2.7 Å

PDB Description: Structure of D-hydantoinase
PDB Compounds: (C:) D-hydantoinase

SCOP Domain Sequences for d1nfgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfgc2 c.1.9.6 (C:52-381) D-hydantoinase {Burkholderia pickettii [TaxId: 329]}
ggidvhthvetvsfntqsadtfatatvaaacggtttivdfcqqdrghslaeavakwdgma
ggksaidygyhiivldptdsvieelevlpdlgitsfkvfmayrgmnmiddvtllktldka
vktgslvmvhaengdaadylrdkfvaegktapiyhalsrpprveaeataralalaeivna
piyivhvtceesleevmraksrgvralaetcthylyltkedlerpdfegakyvftppara
kkdhdvlwnalrngvfetvssdhcswlfkghkdrgrndfraipngapgveerlmmvyqgv
negrisltqfvelvatrpakvfgmfpqkgt

SCOP Domain Coordinates for d1nfgc2:

Click to download the PDB-style file with coordinates for d1nfgc2.
(The format of our PDB-style files is described here.)

Timeline for d1nfgc2: