Lineage for d1nfga1 (1nfg A:1-51,A:382-457)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1333200Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1333201Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1333259Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 1333260Protein D-hydantoinase [75045] (4 species)
  7. 1333273Species Burkholderia pickettii [TaxId:329] [89437] (1 PDB entry)
  8. 1333274Domain d1nfga1: 1nfg A:1-51,A:382-457 [85632]
    Other proteins in same PDB: d1nfga2, d1nfgb2, d1nfgc2, d1nfgd2
    complexed with zn

Details for d1nfga1

PDB Entry: 1nfg (more details), 2.7 Å

PDB Description: Structure of D-hydantoinase
PDB Compounds: (A:) D-hydantoinase

SCOPe Domain Sequences for d1nfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfga1 b.92.1.3 (A:1-51,A:382-457) D-hydantoinase {Burkholderia pickettii [TaxId: 329]}
mdiiikngtivtadgisradlgikdgkitqiggalgpaertidaagryvfpXiavgsdad
ivlwdpeaemvieqtamhnamdyssyeghkvkgvpktvllrgkvivdegsyvgeptdgkf
lkrrkykq

SCOPe Domain Coordinates for d1nfga1:

Click to download the PDB-style file with coordinates for d1nfga1.
(The format of our PDB-style files is described here.)

Timeline for d1nfga1: