Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Bacterioferritin (cytochrome b1) [47244] (6 species) binds heme between two subunits; 24-mer |
Species Desulfovibrio desulfuricans [TaxId:876] [89025] (3 PDB entries) |
Domain d1nf4a_: 1nf4 A: [85598] complexed with fe2, fec, so4 |
PDB Entry: 1nf4 (more details), 2.05 Å
SCOPe Domain Sequences for d1nf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} nredrkakvievlnkaramelhaihqymnqhyslddmdygelaanmkliaidemrhaenf aerikelggepttqkegkvvtgqavpviyesdadqedatieaysqflkvckeqgdivtar lferiieeeqahltyyenigshiknlgdtylakiagtpsstgtaskgfv
Timeline for d1nf4a_: