SCOPe 2.07: Domain d1nezh_: 1nez H:

Lineage for d1nezh_ (1nez H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD8 [48734] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)

8. Domain d1nezh_: 1nez H: [85593]
   Other proteins in same PDB: d1neza1, d1neza2, d1nezb_, d1nezg2
   complexed with nag

Details for d1nezh_

PDB Entry: 1nez, 2.1 Å

PDB Description: the crystal structure of a tl/cd8aa complex at 2.1a resolution:implications for memory t cell generation, co-receptor preference and affinity

PDB Compounds: (H:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d1nezh_:

Sequence; same for both SEQRES and ATOM records:

>d1nezh_ b.1.1.1 (H:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq

Timeline for d1nezh_:

• d1nezh_ first appeared in SCOP 1.65
  
• d1nezh_ appears in SCOPe 2.06
  
• d1nezh_ appears in the current release, SCOPe 2.08