SCOP 1.73: Domain d1nezg_: 1nez G:

Lineage for d1nezg_ (1nez G:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein CD8 [48734] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries)

8. Domain d1nezg_: 1nez G: [85592]
   Other proteins in same PDB: d1neza1, d1neza2, d1nezb_

Details for d1nezg_

PDB Entry: 1nez, 2.1 Å

PDB Description: the crystal structure of a tl/cd8aa complex at 2.1a resolution:implications for memory t cell generation, co-receptor preference and affinity

PDB Compounds: (G:) T-cell surface glycoprotein CD8 alpha chain

SCOP Domain Sequences for d1nezg_:

Sequence; same for both SEQRES and ATOM records:

>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs
sa

Timeline for d1nezg_:

• d1nezg_ first appeared in SCOP 1.65
  
• d1nezg_ appears in SCOP 1.71
  
• d1nezg_ appears in SCOP 1.75
  
• d1nezg_ appears in the current release, SCOPe 2.08, called d1nezg1