Lineage for d1nezg_ (1nez G:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546516Protein CD8 [48734] (2 species)
  7. 546521Species Mouse (Mus musculus) [TaxId:10090] [48736] (2 PDB entries)
  8. 546522Domain d1nezg_: 1nez G: [85592]
    Other proteins in same PDB: d1neza1, d1neza2, d1nezb_

Details for d1nezg_

PDB Entry: 1nez (more details), 2.1 Å

PDB Description: The Crystal Structure of a TL/CD8aa Complex at 2.1A resolution:Implications for Memory T cell Generation, Co-receptor Preference and Affinity

SCOP Domain Sequences for d1nezg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus)}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs
sa

SCOP Domain Coordinates for d1nezg_:

Click to download the PDB-style file with coordinates for d1nezg_.
(The format of our PDB-style files is described here.)

Timeline for d1nezg_: