Lineage for d1nezb_ (1nez B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746511Domain d1nezb_: 1nez B: [85591]
    Other proteins in same PDB: d1neza1, d1neza2, d1nezg1, d1nezg2, d1nezh_
    complexed with nag

Details for d1nezb_

PDB Entry: 1nez (more details), 2.1 Å

PDB Description: the crystal structure of a tl/cd8aa complex at 2.1a resolution:implications for memory t cell generation, co-receptor preference and affinity
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1nezb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nezb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1nezb_:

Click to download the PDB-style file with coordinates for d1nezb_.
(The format of our PDB-style files is described here.)

Timeline for d1nezb_: