Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), tla(c), H-2 class [TaxId:10090] [89861] (1 PDB entry) |
Domain d1neza2: 1nez A:1-181 [85590] Other proteins in same PDB: d1neza1, d1nezb_, d1nezg1, d1nezg2, d1nezh_ complexed with nag |
PDB Entry: 1nez (more details), 2.1 Å
SCOPe Domain Sequences for d1neza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1neza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), tla(c), H-2 class [TaxId: 10090]} gshslryfytalsrpaisepwyiavgylddtqfarfdsagetgtyklsapwveqegpeyw areteivtsnaqffrenlqtmldyynlsqngshtiqvmygceveffgslfrayeqhgydg qdyialnedlktwtaadmaaeitrskweqagytelrrtylegpckdsllrylenrkktqe c
Timeline for d1neza2:
View in 3D Domains from other chains: (mouse over for more information) d1nezb_, d1nezg1, d1nezg2, d1nezh_ |