Lineage for d1neza2 (1nez A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600487Species Mouse (Mus musculus), tla(c), H-2 class [TaxId:10090] [89861] (1 PDB entry)
  8. 600488Domain d1neza2: 1nez A:1-181 [85590]
    Other proteins in same PDB: d1neza1, d1nezb_, d1nezg_, d1nezh_
    complexed with nag

Details for d1neza2

PDB Entry: 1nez (more details), 2.1 Å

PDB Description: The Crystal Structure of a TL/CD8aa Complex at 2.1A resolution:Implications for Memory T cell Generation, Co-receptor Preference and Affinity

SCOP Domain Sequences for d1neza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), tla(c), H-2 class}
gshslryfytalsrpaisepwyiavgylddtqfarfdsagetgtyklsapwveqegpeyw
areteivtsnaqffrenlqtmldyynlsqngshtiqvmygceveffgslfrayeqhgydg
qdyialnedlktwtaadmaaeitrskweqagytelrrtylegpckdsllrylenrkktqe
c

SCOP Domain Coordinates for d1neza2:

Click to download the PDB-style file with coordinates for d1neza2.
(The format of our PDB-style files is described here.)

Timeline for d1neza2: