SCOPe 2.02: Domain d1neza1: 1nez A:182-274

Lineage for d1neza1 (1nez A:182-274)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
   Uniprot P01901 22-299

8. Domain d1neza1: 1nez A:182-274 [85589]
   Other proteins in same PDB: d1neza2, d1nezb_, d1nezg_, d1nezh_
   complexed with nag

Details for d1neza1

PDB Entry: 1nez, 2.1 Å

PDB Description: the crystal structure of a tl/cd8aa complex at 2.1a resolution:implications for memory t cell generation, co-receptor preference and affinity

PDB Compounds: (A:) H-2 class I histocompatibility antigen, TLA(C) alpha chain

SCOPe Domain Sequences for d1neza1:

Sequence; same for both SEQRES and ATOM records:

>d1neza1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdppkthvthharpegdvtlrcwalgfypahitltwqlngeeliqdtelvetrpagdgtf
qkwaavvvpsgeeqkytchvyheglpepltlrw

Timeline for d1neza1:

• d1neza1 first appeared in SCOP 1.65
  
• d1neza1 appears in SCOPe 2.01
  
• d1neza1 appears in SCOPe 2.03
  
• d1neza1 appears in the current release, SCOPe 2.08