Lineage for d1neza1 (1nez A:182-274)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364706Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)
  8. 364729Domain d1neza1: 1nez A:182-274 [85589]
    Other proteins in same PDB: d1neza2, d1nezb_, d1nezg_, d1nezh_
    complexed with nag

Details for d1neza1

PDB Entry: 1nez (more details), 2.1 Å

PDB Description: The Crystal Structure of a TL/CD8aa Complex at 2.1A resolution:Implications for Memory T cell Generation, Co-receptor Preference and Affinity

SCOP Domain Sequences for d1neza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neza1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdppkthvthharpegdvtlrcwalgfypahitltwqlngeeliqdtelvetrpagdgtf
qkwaavvvpsgeeqkytchvyheglpepltlrw

SCOP Domain Coordinates for d1neza1:

Click to download the PDB-style file with coordinates for d1neza1.
(The format of our PDB-style files is described here.)

Timeline for d1neza1: