Lineage for d1ne2b_ (1ne2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130172Family c.66.1.32: Ta1320-like [89751] (2 protein domains)
  6. 2130179Protein Hypothetical protein Ta1320 [89752] (1 species)
  7. 2130180Species Thermoplasma acidophilum [TaxId:2303] [89753] (1 PDB entry)
  8. 2130182Domain d1ne2b_: 1ne2 B: [85587]
    structural genomics
    complexed with fmt

Details for d1ne2b_

PDB Entry: 1ne2 (more details), 1.75 Å

PDB Description: crystal structure of thermoplasma acidophilum 1320 (apc5513)
PDB Compounds: (B:) hypothetical protein ta1320

SCOPe Domain Sequences for d1ne2b_:

Sequence, based on SEQRES records: (download)

>d1ne2b_ c.66.1.32 (B:) Hypothetical protein Ta1320 {Thermoplasma acidophilum [TaxId: 2303]}
mgikndleirlqklqqqgnfknyleqyptdastaayflieiyndgniggrsvidagtgng
ilacgsyllgaesvtafdidpdaietakrncggvnfmvadvseisgkydtwimnppfgsv
vkhsdrafidkafetsmwiysignakardflrrefsargdvfreekvyitvpriyrhhsy
drarieavifgvrnhsf

Sequence, based on observed residues (ATOM records): (download)

>d1ne2b_ c.66.1.32 (B:) Hypothetical protein Ta1320 {Thermoplasma acidophilum [TaxId: 2303]}
mgikndleirlqklqtdastaayflieiyndgniggrsvidagtgngilacgsyllgaes
vtafdidpdaietakrncggvnfmvadvseisgkydtwimnppfgsvvkhsdrafidkaf
etsmwiysignakardflrrefsargdvfreekvyitvpriyrhhsydrarieavifgvr
nhsf

SCOPe Domain Coordinates for d1ne2b_:

Click to download the PDB-style file with coordinates for d1ne2b_.
(The format of our PDB-style files is described here.)

Timeline for d1ne2b_: