SCOP 1.73: Domain d1ndma1: 1ndm A:1-107

Lineage for d1ndma1 (1ndm A:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1ndma1: 1ndm A:1-107 [85581]
   Other proteins in same PDB: d1ndma2, d1ndmb1, d1ndmb2, d1ndmc_
   a part of Fab HYHEL-26, L chain is identical to HYHEL-63
   mutant

Details for d1ndma1

PDB Entry: 1ndm, 2.1 Å

PDB Description: Crystal structure of Fab fragment of antibody HyHEL-26 complexed with lysozyme

PDB Compounds: (A:) antibody kappa light chain

SCOP Domain Sequences for d1ndma1:

Sequence; same for both SEQRES and ATOM records:

>d1ndma1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
divltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik

Timeline for d1ndma1:

• d1ndma1 first appeared in SCOP 1.65
  
• d1ndma1 appears in SCOP 1.71
  
• d1ndma1 appears in SCOP 1.75
  
• d1ndma1 appears in the current release, SCOPe 2.08