Lineage for d1ndgc_ (1ndg C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 323347Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tussues ans secretions
  7. 323355Species Chicken (Gallus gallus) [TaxId:9031] [53962] (169 PDB entries)
  8. 323467Domain d1ndgc_: 1ndg C: [85580]
    Other proteins in same PDB: d1ndga1, d1ndga2, d1ndgb1, d1ndgb2
    complexed with acy; mutant

Details for d1ndgc_

PDB Entry: 1ndg (more details), 1.9 Å

PDB Description: crystal structure of fab fragment of antibody hyhel-8 complexed with its antigen lysozyme

SCOP Domain Sequences for d1ndgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndgc_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus)}
kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
awwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl

SCOP Domain Coordinates for d1ndgc_:

Click to download the PDB-style file with coordinates for d1ndgc_.
(The format of our PDB-style files is described here.)

Timeline for d1ndgc_: